Know Your Vial · White paper · Revision 2

CJC-1295 / Ipamorelin: A Compelling Case

Sermorelin, tesamorelin and the CJC-1295 / ipamorelin pair all ask your pituitary to release more of its own growth hormone. Viewed through a chemistry, manufacturing and controls (CMC) lens, the pair has four structural advantages. Here is the case, residue by residue, and where the evidence stops.

Updated By John Phipps · Revision 2, October 23, 2026 · Download the PDF

At a glance: three GH-pathway therapies compared

All three work upstream of growth hormone, and none of them is growth hormone. Each asks the pituitary to release its own GH in pulses, so the body's feedback controls, including somatostatin and IGF-1, stay in play.

Figures come from different studies with different populations, doses and durations. They show that each molecule is active on the GH axis, not that the results are interchangeable. Compounded medications are not FDA-approved, and individual results vary.

The four molecules, residue by residue

Three of the four are built on human growth hormone–releasing hormone (GHRH). Ipamorelin belongs to a separate class, derived from the ghrelin-mimetic peptide GHRP-1. In the one-letter code below, lowercase a is D-alanine, and every molecule ends in a C-terminal amide (-NH2).

hGHRH(1–44)     YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Tesamorelin     Hex-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Sermorelin      YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
CJC-1295 no DAC YaDAIFTQSYRKVLAQLSARKLLQDILSR-NH2
Ipamorelin      Aib-His-D-2Nal-D-Phe-Lys-NH2

1. Built for solution stability

Native GHRH breaks down in water by two main chemical routes. Asparagine at position 8 rearranges (deamidation and isomerization), and methionine at position 27 oxidizes. Both sharply reduce activity.⁸ For a ready-to-use solution, these are the reactions that set the shelf life. The four molecules handle them in four different ways.

Sermorelin is the native sequence, so it carries both weak points unprotected. Its stability in solution depends heavily on formulation.

Tesamorelin keeps the full native 44-residue sequence, so it still contains Asn8 and Met27, plus a second asparagine at position 35. The branded product manages this through formulation rather than structure: it is supplied as a lyophilized powder, and the newest version, Egrifta WR, holds for 7 days at room temperature after reconstitution, with a cyclodextrin excipient.¹⁰

CJC-1295 (no DAC) fixes the same weak points in the sequence itself. Glutamine replaces asparagine 8 and leucine replaces methionine 27. In the original analog work, substitutions of this kind measurably slowed degradation in solution.^8,9

Ipamorelin is a five-residue peptide, three of them non-natural (Aib, D-2-naphthylalanine and D-phenylalanine). It has no asparagine, methionine or cysteine, so it lacks the most common chemical degradation sites. Its one histidine is a minor oxidation risk.

Aggregation

Length and lipidation matter as well. At 44 residues with an N-terminal fatty-acid cap, tesamorelin has far more hydrophobic surface than the shorter molecules. Peptides of this kind tend to self-associate in solution, especially at higher concentrations or under agitation or temperature stress. Aggregation lowers the amount of active peptide and can increase the risk of immune reactions. Sermorelin and CJC-1295 (no DAC) are 29 residues with no lipid cap, and ipamorelin is far too small to aggregate in the same way. This is a structural tendency; published studies directly comparing aggregation of these peptides are not available.

Manufacturability

Shorter chains are also easier to make cleanly. Peptides are built one amino acid at a time, and each coupling step leaves a small fraction of incomplete chains. Those losses compound with every residue added.

2. Two receptor pathways

The pituitary's GH output is governed by two stimulatory signals. GHRH, released from the hypothalamus, acts on the GHRH receptor to set how much GH each pulse releases. Ghrelin acts on a separate receptor (GHS-R1a) to trigger pulses and to oppose somatostatin, the hormone that holds GH back. The two receptors signal through different pathways inside the cell.

The pair puts one agent on each receptor:

• CJC-1295 (GHRH receptor): a modified GHRH analog that increases the size of GH pulses. With continuous stimulation it raised baseline and average GH while preserving the body's normal pulse pattern.³
• Ipamorelin (ghrelin receptor): a selective agonist that produced a single, dose-dependent GH pulse in healthy volunteers, peaking about 40 minutes after dosing.⁴ In animal studies it released GH without the rises in cortisol and ACTH seen with older ghrelin-receptor peptides.⁵ Ipamorelin does not act on the GHRH receptor.

3. Strong GH stimulation, with the brake eased

Somatostatin is the brake on GH release. A GHRH-receptor drug pushes against that brake but cannot ease it. A ghrelin-receptor agonist works on both sides: it starts the pulse and counters somatostatin's hold on the pituitary. Because the two signals work through independent mechanisms, activating both at once does more than add their effects together.

That synergy is well established in humans. In 1990, Bowers and colleagues showed that a ghrelin-receptor peptide and GHRH given together released GH synergistically in healthy men.¹ Popovic and colleagues later measured total GH release in healthy control subjects:²

What the GH and IGF-1 numbers show

GH and IGF-1 are the standard markers that the GH axis has been switched on. All three therapies have evidence on them:

• Tesamorelin: IGF-1 rose about 81% after 26 weeks of daily dosing in adults with HIV and abdominal fat.⁶
• Sermorelin: twice-daily injections for 14 days reversed the age-related drop in GH and IGF-1 in healthy older men.¹² Nightly dosing of a closely related GHRH(1–29) analog for 16 weeks raised nocturnal GH in older men and women, with anabolic effects that favored men.¹³
• CJC-1295: a single dose of the long-acting DAC form raised GH 2- to 10-fold for 6 days or more and IGF-1 1.5- to 3-fold for 9–11 days in healthy adults aged 21–61.⁷
• Ipamorelin: a dose-dependent GH pulse in healthy volunteers.⁴

These figures support the claim that the pair is biologically active on the same axis as sermorelin and tesamorelin. They do not show that it produces the same clinical results, for three reasons:

• the studies differ in population, duration and dosing
• the CJC-1295 data come from the long-acting DAC form, while most compounded preparations use the short-acting no-DAC form
• no published study has measured IGF-1 with the combined pair

4. Resists degradation, keeps potency

In the blood, the enzyme DPP-4 cuts native GHRH between positions 2 and 3 and inactivates it. That is why sermorelin, which carries the native sequence, has a half-life measured in minutes.¹⁴ Tesamorelin blocks the cut with its N-terminal cap. CJC-1295 blocks it with a single D-alanine at position 2.

CJC-1295's commonly cited half-life of about 30 minutes is roughly two to three times sermorelin's and in the same range as tesamorelin's. Ipamorelin, with no DPP-4 site and three non-natural residues, lasts about 2 hours in people.⁴

Staying intact is only half the story; the design also kept, and improved, activity. The Ala15 substitution strengthens receptor binding, and analogs built this way were several times more potent than native GHRH.⁸ Because Gln8 and Leu27 remove the deamidation and oxidation sites, that potency is also better protected in the vial.⁸

Longer is not automatically better. The short half-lives of all three GHRH-receptor drugs preserve the body's natural on-off GH pulses. The long-acting DAC form of CJC-1295, which lasts days, is a different molecule and is not the one discussed here.

What the evidence does not show

• No randomized trial has tested the combined CJC-1295 / ipamorelin pair.
• No clinical outcome, such as visceral fat, lean mass, sleep or recovery, has been shown for either peptide in humans.
• The strongest CJC-1295 human data are for the long-acting DAC form, not the no-DAC form discussed here.
• The stability advantages are predicted from structure. Published stability data for compounded solutions of these peptides are not available.
• Ipamorelin's one efficacy trial, for bowel recovery after surgery, found it well tolerated but no better than placebo.¹¹
• Sermorelin's adult studies are small and short, and women responded less than men.¹³
• Long-term safety of raising GH and IGF-1 with any of these peptides in healthy adults has not been established.

References

1. Bowers CY, Reynolds GA, Durham D, et al. Growth hormone (GH)-releasing peptide stimulates GH release in normal men and acts synergistically with GH-releasing hormone. J Clin Endocrinol Metab. 1990;70(4):975–982. doi:10.1210/jcem-70-4-975
2. Popovic V, Damjanovic S, Micic D, et al. Blocked growth hormone-releasing peptide (GHRP-6)-induced GH secretion and absence of the synergic action of GHRP-6 plus GH-releasing hormone in patients with hypothalamopituitary disconnection. J Clin Endocrinol Metab. 1995;80(3):942–947. doi:10.1210/jcem.80.3.7883854 (healthy subjects served as controls)
3. Ionescu M, Frohman LA. Pulsatile secretion of growth hormone (GH) persists during continuous stimulation by CJC-1295, a long-acting GH-releasing hormone analog. J Clin Endocrinol Metab. 2006;91(12):4792–4797. doi:10.1210/jc.2006-1702
4. Gobburu JV, Agersø H, Jusko WJ, Ynddal L. Pharmacokinetic-pharmacodynamic modeling of ipamorelin, a growth hormone releasing peptide, in human volunteers. Pharm Res. 1999;16(9):1412–1416. doi:10.1023/a:1018955126402
5. Raun K, Hansen BS, Johansen NL, et al. Ipamorelin, the first selective growth hormone secretagogue. Eur J Endocrinol. 1998;139(5):552–561.
6. Falutz J, Allas S, Blot K, et al. Metabolic effects of a growth hormone-releasing factor in patients with HIV. N Engl J Med. 2007;357(23):2359–2370.
7. Teichman SL, Neale A, Lawrence B, et al. Prolonged stimulation of growth hormone (GH) and insulin-like growth factor I secretion by CJC-1295, a long-acting analog of GH-releasing hormone, in healthy adults. J Clin Endocrinol Metab. 2006;91(3):799–805. doi:10.1210/jc.2005-1536
8. Enhanced stability and potency of novel growth hormone-releasing factor (GRF) analogues derived from rodent and human GRF sequences. Peptides. 1994.
9. US Patent 7,268,113. Long lasting growth hormone releasing factor derivatives (ConjuChem).
10. Theratechnologies Inc. EGRIFTA (tesamorelin for injection) U.S. Prescribing Information, including EGRIFTA SV and EGRIFTA WR.
11. Beck DE, Sweeney WB, McCarter MD; Ipamorelin 201 Study Group. Prospective, randomized, controlled, proof-of-concept study of the ghrelin mimetic ipamorelin for the management of postoperative ileus in bowel resection patients. Int J Colorectal Dis. 2014;29(12):1527–1534.
12. Corpas E, Harman SM, Piñeyro MA, Roberson R, Blackman MR. Growth hormone (GH)-releasing hormone-(1-29) twice daily reverses the decreased GH and insulin-like growth factor-I levels in old men. J Clin Endocrinol Metab. 1992;75(2):530–535. doi:10.1210/jcem.75.2.1379256
13. Khorram O, Laughlin GA, Yen SS. Endocrine and metabolic effects of long-term administration of [Nle27]growth hormone-releasing hormone-(1-29)-NH2 in age-advanced men and women. J Clin Endocrinol Metab. 1997;82(5):1472–1479.
14. Prakash A, Goa KL. Sermorelin: a review of its use in the diagnosis and treatment of children with idiopathic growth hormone deficiency. BioDrugs. 1999;12(2):139–157.

Revision history. Revision 2, October 23, 2026: reorganized around four CMC arguments; added the full amino acid sequences, a residue-level stability map, a receptor diagram, and GH-synergy, half-life and synthesis-yield charts. Revision 1, October 9, 2026: original white paper.

This article is for educational purposes and is not medical advice. CJC-1295 and ipamorelin are not FDA-approved. Sermorelin and tesamorelin are available from AJ Peptide by prescription only, after evaluation by a licensed provider. Compounded medications are not FDA-approved and have not been evaluated by FDA for safety, effectiveness or quality. Clinical findings described above come from published studies of the referenced drugs in the populations studied; individual results vary. AJ Peptide LLC sources exclusively through licensed U.S. 503A compounding pharmacies.

AJ Peptide is LegitScript certified.